[Back to home page]

[Back to bacterial introns]

Cu.me.I1


Source: Cupriavidus metallidurans CH34

Domain: bacteria

ORF Class: CL1

RNA Type: IIB1

Host Gene: Uncertain

Locus: Chromosome

GenBank: CP000352.1:3134534-3137479


Intron and Flanking Sequence

Black: flanking sequence
Red: intron sequence
Blue: ORF sequence
Green: Twintron sequence (including both RNA and ORF sequences)

5' end

   1 cgagcagctt ggctcgcgtt tcggtgtcca gttgcggccc gggcgggggc aggatcttgt
  61 tgagcagcgc gttcaagtgt ggcgtggcac gtaaggcgac gttcttcgtc gctgcaactg
 121 gcatcagaca agtctgccga cgttgcagaa atcgcgcaat tttgttgcaa gtggggcata
 181 tcatgccgat ttttgcggcg ccgcgccatt gcgaggcgcc ccaataaccc acaaatttgt
 241 caaaagcacc acgtttgtgg ggggcgtgtg tcgaaagcgc gcgccagacc agcgtcaaat
 301 tggtcggccg gcaggctttt cgggcggcaa accggtggtt cgccttataa tgcccccttt
 361 cgtgcgacac gcaccctcgt gtccggtagc tctacgttaa gagcatcgac ctttgttgag
 421 acaaggggaa ggcttcggcc agaaccgtcc aatctcaacc atttcttgct ttgacaaacc
 481 cggccgcaag gccggagcga gtccatgtgt tgcgaggagg ccaaagtatc ggccgactca
 541 aagcttgctt tctgctggat ggatttccag ccattgccca aaggcgggga cgcttgcctt
 601 tgggcaggtg tctttgcagt acgcactctc tacggaggtg tgggcgaata tgcggcggta
 661 atttgctgcg tcttcgctac atagcattca aaccggccca gtagggtcgg cgctacgtct
 721 ttgggatgga ggcgggcgcg tcagcgtctg tcttcatcga gcgcctgcca gtatggaggc
 781 actgaagtaa tgaagtgagg tttccggagc gtttagctct gcgcgttatg gttcggtcga
 841 atacacccgc gagggtgcct cgatagagaa cctgctatgc gactagcagt agcctaggga
 901 gacatgcgtc acgggtaact gtggggtgtg aagctctcct gacaacgaag cccccgcaag
 961 ggtgcgtaac tgccgagagg tagagacgca gagactccta gcagcaatgg ggtcgaggag
1021 ccaggctggc tggtatgggc aacatatgtg aactgctgat aaacaccgta agcattgcag
1081 tgccaaagct gctgataggc actaaccaaa aggtatgtgg tcggttgttc cgctgaaagt
1141 tcggaacacg tcgccattcg gaccaccggt gaagaggcag gccctaaccc agtcgtgtaa
1201 tgcgcaggga acgtggtaag cccgtatggc tgccggagcg cggtatggct ccggcaagcg
1261 aaccgcaagg aacgctgttg gctgtgcggg tatgggaggt tggaaaaagc gaatgccggg
1321 ctgtaatggt ccggataggg gttgagacat tacctcacgc gaaagcgggc agacttccaa
1381 ctggtctttc gtcgcaagac ggctgactga actcgcttgt ttaattttct tcccttgggg
1441 ggtgatatgc ccctcaaggg gcatgttgtc tccgttgtct tgggaagtcc tcaagattgg
1501 agagcagcat ggaagcattg atccgtgagg atgaatctgc gccctccggc atcccgcagc
1561 gatggggcga catcaattgg cgccgcgtcg aacggaatgt tcgggcaatg cagattcgaa
1621 ttgcgaaggc aacacaggaa ggggattggc gcagggtgaa aaccttgcaa cggtccctga
1681 cccgctcgtt ttctgccaag gcatcggcgg taaggcgagt ggcgatgaac caaggagcgc
1741 ggacggctgg tgtcgaccgc gttgcgtggg actcgcctga agctcgatgg gaatccattg
1801 ggaggttgaa gcgccggggg tatcgtccgc tgccgttaag gcgggtgtac atccccaagg
1861 cgaatgggaa ggaacgcccc ttgggcattc caactctgca cgaccgagcc atgcaggcgc
1921 tatacctgct ggcgctggag ccggtgtccg aggggacgag cgatccgaac tcttacgggt
1981 ttcggattaa tcgttcgact gcggatgcca tgtcccagct gtttgtctcc ttgtccaaaa
2041 aggcttcggc ccaatgggtg ctggaggcag acattaaagg atgcttcgac catatcagcc
2101 acgactggct ggagcgcaat gtccccatgg acaaagcgat ccttcggaag tggttgaagg
2161 ctggcgtggt atttcaaagc cagtttcagg cgaccgatgc tggaacacca caggggggca
2221 tcatttcccc aaccttggcc aacgtggcac tgaatggact ggaacgtgac ctgatgaagt
2281 tcttacgaac gaaactcggg actgtccagg ccaacaggct aaaggtgaat gtcgtgcggt
2341 acgcggacga cttcgtgatc accggcaata cgccggaagt tttggagcac gaagtgaagc
2401 cgtgggtaga acagttccta gcagtacggg gactcactct ttccccggag aaaacgcgaa
2461 tcgtgaacat cgccgatggc tttgacttcc ttgggtggaa tttccggaag tattcgggaa
2521 cgctgctcat caagccgagc aagaagaacg cactagcgtt ctatcgcagg gtcaaggagg
2581 ttatcaggac acaccatggg aaaaagccgg aggatctgat ccgaacgctg aacccgatgc
2641 tgaggggttg ggcacagtat cacggcccag tggttgcaaa ggcggcgttc acccgaatgg
2701 agcacctgat cttcaggtgt ctatggaggt gggcaaaacg gcgacaccga gggaagaata
2761 ccgagtgggt gcggaagaag tactttgcct caatcggaat gcggaactgg gtgtttggaa
2821 ccaacgtttt gggtaaggct ggcgaacgct actggatgga gttgtattcg ataccgagta
2881 cgcctattcg gaggcacaag aaggttcgag gggactacaa ccccttcgac ccagcgcagg
2941 aaatgtatgg cgaaacgctg cggcaggaac gcatggcaga aagcatgtcg taccgaaagc
3001 agtgggcaaa gctgttcatg tcccagcggg gcttatgcgc ggtatgccaa ggcaagataa
3061 ccaaagagac aagatggcat gaccatcaca tcgaaccacg ggtttccggt ggctcggacg
3121 ctctagggaa tcgagttctg gtgcaccccg actgtcatgt ccaagttcac tcctatggtc
3181 aagttgcagt gaagccggtg tttgattaa
c tcattcattt tgtagaggct tgagccgtat
3241 gcggggaaac tcgcacgtac ggttcttagg ggggagcatt gccagtgatg gtatgctcct
3301 accctcc
cca aaaacgctcg tccgccgtcc tcgtgaaagt cttccgcggt ctgcccaatg
3361 ccgaaagccg ggcgccttgc gcgcttacca tcggcaattt cgacggtgtg catcgcggcc
3421 accagtcgtt gctcgcgcgc gcccgcgcgg ccgccgatgc acgcggcctg ccgctgtgcg
3481 tgatgacatt cgagccgcat ccgcgcgaat tcttcgcccc cgagcacgct cccacccgta
3541 tcgccctgct gcgcgacaag ctcgacgcgc tgcgccgcaa cggcgtggat cgcgtggtgg
3601 tggagcattt caacgcgcat ttcgccgccc agtcgcctca ggctttcgtc gagaacgtgc
3661 tctggcacgg cctccacgcc cgatgggtgc tggttggcga cgacttccgc ttcggcgcca

3' end

[Top]


ORF Sequence

ORF domains: RT-X-En

ORF size (aa): 566

Predicted ORF Function: yes

Predicted EN Function: Yes

ORF Sequence:

MEALIREDESAPSGIPQRWGDINWRRVERNVRAMQIRIAKATQEGDWRRVKTLQRSLTRS
FSAKASAVRRVAMNQGARTAGVDRVAWDSPEARWESIGRLKRRGYRPLPLRRVYIPKANG
KERPLGIPTLHDRAMQALYLLALEPVSEGTSDPNSYGFRINRSTADAMSQLFVSLSKKAS
AQWVLEADIKGCFDHISHDWLERNVPMDKAILRKWLKAGVVFQSQFQATDAGTPQGGIIS
PTLANVALNGLERDLMKFLRTKLGTVQANRLKVNVVRYADDFVITGNTPEVLEHEVKPWV
EQFLAVRGLTLSPEKTRIVNIADGFDFLGWNFRKYSGTLLIKPSKKNALAFYRRVKEVIR
THHGKKPEDLIRTLNPMLRGWAQYHGPVVAKAAFTRMEHLIFRCLWRWAKRRHRGKNTEW
VRKKYFASIGMRNWVFGTNVLGKAGERYWMELYSIPSTPIRRHKKVRGDYNPFDPAQEMY
GETLRQERMAESMSYRKQWAKLFMSQRGLCAVCQGKITKETRWHDHHIEPRVSGGSDALG
NRVLVHPDCHVQVHSYGQVAVKPVFD

[Top]


Secondary Structure

Secondary structure not yet available.

[Top]